SCOPe 2.05: Domain d2m3sa_: 2m3s A:

Lineage for d2m3sa_ (2m3s A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Calmodulin [47516] (12 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [47520] (9 PDB entries)
   mutant with a two residue deletion in the central helix

8. Domain d2m3sa_: 2m3s A: [243093]
   automated match to d2obha_
   complexed with ca; mutant

Details for d2m3sa_

PDB Entry: 2m3s

PDB Description: Calmodulin, i85l, f92e, h107i, l112r, a128t, m144r mutant

PDB Compounds: (A:) calmodulin

SCOPe Domain Sequences for d2m3sa_:

Sequence; same for both SEQRES and ATOM records:

>d2m3sa_ a.39.1.5 (A:) Calmodulin {Chicken (Gallus gallus) [TaxId: 9031]}
slmadqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevda
dgngtidfpefltmmarkmkdtdseeelreafrvedkdgngyisaaelrivmtnrgeklt
deevdemiretdidgdgqvnyeefvqrmtak

Timeline for d2m3sa_:

• d2m3sa_ first appeared in SCOPe 2.04
  
• d2m3sa_ is called d2m3sa1 in SCOPe 2.06
  
• d2m3sa_ appears in the current release, SCOPe 2.08, called d2m3sa1