Lineage for d2m2wa_ (2m2w A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239289Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2239518Protein DNA polymerase X [69885] (1 species)
  7. 2239519Species African swine fever virus [TaxId:10497] [69886] (6 PDB entries)
  8. 2239521Domain d2m2wa_: 2m2w A: [243082]
    automated match to d1jqra_
    protein/DNA complex; complexed with dgt, mg

Details for d2m2wa_

PDB Entry: 2m2w (more details)

PDB Description: Ternary complex of ASFV Pol X with DNA and MgdGTP
PDB Compounds: (A:) Repair DNA polymerase X

SCOPe Domain Sequences for d2m2wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m2wa_ d.218.1.2 (A:) DNA polymerase X {African swine fever virus [TaxId: 10497]}
mltliqgkkivnhlrsrlafeyngqlikilsknivavgslrreekmlndvdlliivpekk
llkhvlpnirikglsfsvkvcgerkcvlfiewekktyqldlftalaeekpyaifhftgpv
syliriraalkkknyklnqyglfknqtlvplkittekelikelgftyripkkrl

SCOPe Domain Coordinates for d2m2wa_:

Click to download the PDB-style file with coordinates for d2m2wa_.
(The format of our PDB-style files is described here.)

Timeline for d2m2wa_: