SCOPe 2.08: Domain d2m1ra1: 2m1r A:188-249

Lineage for d2m1ra1 (2m1r A:188-249)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
   dimetal(zinc)-bound alpha+beta fold

4. Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families)

5. Family g.50.1.2: PHD domain [57911] (14 proteins)

6. Protein automated matches [190654] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)

8. Domain d2m1ra1: 2m1r A:188-249 [243076]
   Other proteins in same PDB: d2m1ra2
   automated match to d1wena_
   complexed with zn; mutant

Details for d2m1ra1

PDB Entry: 2m1r

PDB Description: PHD domain of ING4 N214D mutant

PDB Compounds: (A:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2m1ra1:

Sequence; same for both SEQRES and ATOM records:

>d2m1ra1 g.50.1.2 (A:188-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmpvdpneptyclchqvsygemigcddpdcsiewfhfacvglttkprgkwfcprcsqerk
kk

Timeline for d2m1ra1:

• d2m1ra1 first appeared in SCOPe 2.04, called d2m1ra_
  
• d2m1ra1 appears in SCOPe 2.07