Lineage for d2m1ra1 (2m1r A:188-249)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2588901Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2588902Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2588925Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2588974Protein automated matches [190654] (2 species)
    not a true protein
  7. 2588975Species Human (Homo sapiens) [TaxId:9606] [188436] (5 PDB entries)
  8. 2588981Domain d2m1ra1: 2m1r A:188-249 [243076]
    Other proteins in same PDB: d2m1ra2
    automated match to d1wena_
    complexed with zn; mutant

Details for d2m1ra1

PDB Entry: 2m1r (more details)

PDB Description: PHD domain of ING4 N214D mutant
PDB Compounds: (A:) Inhibitor of growth protein 4

SCOPe Domain Sequences for d2m1ra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m1ra1 g.50.1.2 (A:188-249) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmpvdpneptyclchqvsygemigcddpdcsiewfhfacvglttkprgkwfcprcsqerk
kk

SCOPe Domain Coordinates for d2m1ra1:

Click to download the PDB-style file with coordinates for d2m1ra1.
(The format of our PDB-style files is described here.)

Timeline for d2m1ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m1ra2