SCOPe 2.08: Domain d2m10a1: 2m10 A:2-97

Lineage for d2m10a1 (2m10 A:2-97)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein Phosphatase hPTP1e [50168] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50169] (9 PDB entries)

8. Domain d2m10a1: 2m10 A:2-97 [243071]
   Other proteins in same PDB: d2m10a2
   automated match to d1d5ga_
   complexed with 33b

Details for d2m10a1

PDB Entry: 2m10

PDB Description: trans form of a photoswitchable PDZ domain crosslinked with an azobenzene derivative

PDB Compounds: (A:) Tyrosine-protein phosphatase non-receptor type 13

SCOPe Domain Sequences for d2m10a1:

Sequence; same for both SEQRES and ATOM records:

>d2m10a1 b.36.1.1 (A:2-97) Phosphatase hPTP1e {Human (Homo sapiens) [TaxId: 9606]}
pkpgdifevelakndnslgicvtggvntsvrhggiyvkavipqgaaesdgrihkgdrvla
vngvslegathkqavctlrntgqvvhlllekgqspt

Timeline for d2m10a1:

• d2m10a1 first appeared in SCOPe 2.04, called d2m10a_
  
• d2m10a1 appears in SCOPe 2.07