SCOPe 2.06: Domain d2m0ra_: 2m0r A:

Lineage for d2m0ra_ (2m0r A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (51 PDB entries)

8. Domain d2m0ra_: 2m0r A: [243064]
   automated match to d2h2kb_

Details for d2m0ra_

PDB Entry: 2m0r

PDB Description: Solution structure and dynamics of human S100A14

PDB Compounds: (A:) Protein S100-A14

SCOPe Domain Sequences for d2m0ra_:

Sequence; same for both SEQRES and ATOM records:

>d2m0ra_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mgqcrsanaedaqefsdveraietliknfhqysveggketltpselrdlvtqqlphlmps
ncgleekianlgscndsklefrsfweligeaaksvklerpvrgh

Timeline for d2m0ra_:

• d2m0ra_ first appeared in SCOPe 2.04
  
• d2m0ra_ appears in SCOPe 2.05
  
• d2m0ra_ appears in SCOPe 2.07
  
• d2m0ra_ appears in the current release, SCOPe 2.08