Lineage for d2m0ca1 (2m0c A:4-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982516Species Human (Homo sapiens) [TaxId:9606] [189258] (25 PDB entries)
  8. 1982523Domain d2m0ca1: 2m0c A:4-75 [243059]
    Other proteins in same PDB: d2m0ca2
    automated match to d1ftta_

Details for d2m0ca1

PDB Entry: 2m0c (more details)

PDB Description: Solution NMR Structure of Homeobox Domain of Human ALX4, Northeast Structural Genomics Consortium (NESG) Target HR4490C
PDB Compounds: (A:) Homeobox protein aristaless-like 4

SCOPe Domain Sequences for d2m0ca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2m0ca1 a.4.1.0 (A:4-75) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snkgkkrrnrttftsyqleelekvfqkthypdvyareqlamrtdltearvqvwfqnrrak
wrkrerfgqmqq

SCOPe Domain Coordinates for d2m0ca1:

Click to download the PDB-style file with coordinates for d2m0ca1.
(The format of our PDB-style files is described here.)

Timeline for d2m0ca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2m0ca2