Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) |
Family d.109.1.0: automated matches [191561] (1 protein) not a true family |
Protein automated matches [190971] (14 species) not a true protein |
Species Nematode (Caenorhabditis elegans) [TaxId:6239] [255468] (3 PDB entries) |
Domain d2lxxa_: 2lxx A: [243031] automated match to d4keea_ |
PDB Entry: 2lxx (more details)
SCOPe Domain Sequences for d2lxxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lxxa_ d.109.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} masgvkvdpscknaydllhnkhqhsyiifkidkndtaivvekvgeknapyaefveemkkl vedgkecryaavdvevtvqrqgaegtstlnkvifvqycpdnapvrrrmlyassvralkas lgleslfqvqasemsdldeksvksdlmsnqri
Timeline for d2lxxa_: