Lineage for d2ls8a1 (2ls8 A:3-134)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 2559971Domain d2ls8a1: 2ls8 A:3-134 [242987]
    Other proteins in same PDB: d2ls8a2, d2ls8a3
    automated match to d1xpha_

Details for d2ls8a1

PDB Entry: 2ls8 (more details)

PDB Description: Solution structure of human C-type lectin domain family 4 member D
PDB Compounds: (A:) C-type lectin domain family 4 member D

SCOPe Domain Sequences for d2ls8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ls8a1 d.169.1.0 (A:3-134) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cpidwrafqsncyfpltdnktwaeserncsgmgahlmtisteaeqnfiiqfldrrlsyfl
glrdenakgqwrwvdqtpfnprrvfwhknepdnsqgencvvlvynqdkwawndvpcnfea
srickipgttln

SCOPe Domain Coordinates for d2ls8a1:

Click to download the PDB-style file with coordinates for d2ls8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ls8a1: