Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
Domain d2lqra_: 2lqr A: [242970] automated match to d3puca_ |
PDB Entry: 2lqr (more details)
SCOPe Domain Sequences for d2lqra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lqra_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ggsnatapffemklkhykifegmpvtftcrvagnpkpkiywfkdgkqispksdhytiqrd ldgtcslhttastldddgnytimaanpqgrvsctgrlmvqavnqrgrs
Timeline for d2lqra_: