| Class b: All beta proteins [48724] (176 folds) |
| Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
| Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins) Pfam PF00640 |
| Protein Tensin [141421] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [141422] (2 PDB entries) Uniprot Q9UPS7 1139-1285 Tensin2 |
| Domain d2loza_: 2loz A: [242952] automated match to d2dkqa1 |
PDB Entry: 2loz (more details)
SCOPe Domain Sequences for d2loza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2loza_ b.55.1.2 (A:) Tensin {Human (Homo sapiens) [TaxId: 9606]}
mstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvhfkvsaqg
itltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenvch
lfaeldpdqpagaivtfitkvllgqrk
Timeline for d2loza_: