Lineage for d2loza_ (2loz A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1550800Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1550801Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1551068Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
    Pfam PF00640
  6. 1551121Protein Tensin [141421] (2 species)
  7. 1551124Species Human (Homo sapiens) [TaxId:9606] [141422] (2 PDB entries)
    Uniprot Q9UPS7 1139-1285
    Tensin2
  8. 1551125Domain d2loza_: 2loz A: [242952]
    automated match to d2dkqa1

Details for d2loza_

PDB Entry: 2loz (more details)

PDB Description: the novel binding mode of dlc1 and tensin2 ptb domain
PDB Compounds: (A:) Tensin-like C1 domain-containing phosphatase

SCOPe Domain Sequences for d2loza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2loza_ b.55.1.2 (A:) Tensin {Human (Homo sapiens) [TaxId: 9606]}
mstaadllrqgaacsvlyltsvetesltgpqavarassaalscsprptpavvhfkvsaqg
itltdnqrklffrrhypvnsitfsstdpqdrrwtnpdgttskifgfvakkpgspwenvch
lfaeldpdqpagaivtfitkvllgqrk

SCOPe Domain Coordinates for d2loza_:

Click to download the PDB-style file with coordinates for d2loza_.
(The format of our PDB-style files is described here.)

Timeline for d2loza_: