SCOPe 2.04: Domain d2lnba_: 2lnb A:

Lineage for d2lnba_ (2lnb A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (10 PDB entries)

8. Domain d2lnba_: 2lnb A: [242942]
   automated match to d1j75a_

Details for d2lnba_

PDB Entry: 2lnb

PDB Description: Solution NMR structure of N-terminal domain (6-74) of human ZBP1 protein, Northeast Structural Genomics Consortium Target HR8174A.

PDB Compounds: (A:) Z-DNA-binding protein 1

SCOPe Domain Sequences for d2lnba_:

Sequence; same for both SEQRES and ATOM records:

>d2lnba_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhshmadpgreghleqrilqvlteagspvklaqlvkecqapkrelnqvlyrmkk
elkvsltspatwclggtdpe

Timeline for d2lnba_:

• d2lnba_ is new in SCOPe 2.04-stable
  
• d2lnba_ appears in SCOPe 2.05
  
• d2lnba_ appears in the current release, SCOPe 2.08, called d2lnba1