Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (36 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255450] (3 PDB entries) |
Domain d2lmva_: 2lmv A: [242941] automated match to d2mysb_ complexed with ca |
PDB Entry: 2lmv (more details)
SCOPe Domain Sequences for d2lmva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lmva_ a.39.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} selteeqiaefkdafvqfdkegtgkiatrelgtlmrtlgqnpteaelqdliaeaennnng qlnftefcgimakqmretdteeemreafkifdrdgdgfispaelrfvminlgekvtdeei demireadfdgdgminyeefvwmisqk
Timeline for d2lmva_: