Lineage for d2lmta_ (2lmt A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1733371Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1733372Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1734668Family a.39.1.0: automated matches [191396] (1 protein)
    not a true family
  6. 1734669Protein automated matches [190513] (27 species)
    not a true protein
  7. 1734704Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255450] (3 PDB entries)
  8. 1734707Domain d2lmta_: 2lmt A: [242939]
    automated match to d2mysb_
    complexed with ca

Details for d2lmta_

PDB Entry: 2lmt (more details)

PDB Description: NMR structure of Androcam
PDB Compounds: (A:) Calmodulin-related protein 97A

SCOPe Domain Sequences for d2lmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lmta_ a.39.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mselteeqiaefkdafvqfdkegtgkiatrelgtlmrtlgqnpteaelqdliaeaennnn
gqlnftefcgimakqmretdteeemreafkifdrdgdgfispaelrfvminlgekvtdee
idemireadfdgdgminyeefvwmisqk

SCOPe Domain Coordinates for d2lmta_:

Click to download the PDB-style file with coordinates for d2lmta_.
(The format of our PDB-style files is described here.)

Timeline for d2lmta_: