Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (70 species) not a true protein |
Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226434] (2 PDB entries) |
Domain d2lm3a1: 2lm3 A:292-495 [242932] Other proteins in same PDB: d2lm3a2 automated match to d2voka_ |
PDB Entry: 2lm3 (more details)
SCOPe Domain Sequences for d2lm3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lm3a1 b.29.1.0 (A:292-495) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]} eltdarrywvdvtlatnnishaviaedkrqvssrnpqimyqapgtlftfpsltnfnyctg vlgsqsitsgkhywevdvskksawilgvcagfqsdamynieqnenyqpkygywviglqeg vkysvfqdgsshtpfapfivplsviicpdrvgvfvdyeactvsffnitnhgfliykfsqc sfskpvfpylnprkctvpmtlcsp
Timeline for d2lm3a1: