Lineage for d2lm3a1 (2lm3 A:292-495)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781253Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226434] (2 PDB entries)
  8. 2781255Domain d2lm3a1: 2lm3 A:292-495 [242932]
    Other proteins in same PDB: d2lm3a2
    automated match to d2voka_

Details for d2lm3a1

PDB Entry: 2lm3 (more details)

PDB Description: Structure of the rhesus monkey TRIM5alpha PRYSPRY domain
PDB Compounds: (A:) Tripartite motif-containing protein 5

SCOPe Domain Sequences for d2lm3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lm3a1 b.29.1.0 (A:292-495) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
eltdarrywvdvtlatnnishaviaedkrqvssrnpqimyqapgtlftfpsltnfnyctg
vlgsqsitsgkhywevdvskksawilgvcagfqsdamynieqnenyqpkygywviglqeg
vkysvfqdgsshtpfapfivplsviicpdrvgvfvdyeactvsffnitnhgfliykfsqc
sfskpvfpylnprkctvpmtlcsp

SCOPe Domain Coordinates for d2lm3a1:

Click to download the PDB-style file with coordinates for d2lm3a1.
(The format of our PDB-style files is described here.)

Timeline for d2lm3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lm3a2