Lineage for d2lhea_ (2lhe A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2541749Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) (S)
  5. 2541750Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins)
  6. 2541879Protein automated matches [190067] (6 species)
    not a true protein
  7. 2541880Species Artificial gene [TaxId:32630] [255434] (4 PDB entries)
  8. 2541883Domain d2lhea_: 2lhe A: [242883]
    automated match to d2igga_

Details for d2lhea_

PDB Entry: 2lhe (more details)

PDB Description: Gb98-T25I,L20A
PDB Compounds: (A:) gb98

SCOPe Domain Sequences for d2lhea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lhea_ d.15.7.1 (A:) automated matches {Artificial gene [TaxId: 32630]}
ttyklilnlkqakeeaikeavdagiaekyfklianaktvegvwtykdeiktftvte

SCOPe Domain Coordinates for d2lhea_:

Click to download the PDB-style file with coordinates for d2lhea_.
(The format of our PDB-style files is described here.)

Timeline for d2lhea_: