Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family) |
Family d.15.7.1: Immunoglobulin-binding domains [54359] (3 proteins) |
Protein automated matches [190067] (6 species) not a true protein |
Species Artificial gene [TaxId:32630] [255434] (4 PDB entries) |
Domain d2lhca_: 2lhc A: [242881] automated match to d1fccc_ |
PDB Entry: 2lhc (more details)
SCOPe Domain Sequences for d2lhca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2lhca_ d.15.7.1 (A:) automated matches {Artificial gene [TaxId: 32630]} ttyklilnlkqakeeaikelvdagtaekyfklianaktvegvwtlkdeiktftvte
Timeline for d2lhca_: