Lineage for d2lf2a1 (2lf2 A:1-167)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214642Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2214908Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2215232Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2215233Protein automated matches [190218] (22 species)
    not a true protein
  7. 2215323Species Cytophaga hutchinsonii [TaxId:269798] [255432] (1 PDB entry)
  8. 2215324Domain d2lf2a1: 2lf2 A:1-167 [242865]
    Other proteins in same PDB: d2lf2a2
    automated match to d3uidb_

Details for d2lf2a1

PDB Entry: 2lf2 (more details)

PDB Description: Solution NMR structure of the AHSA1-like protein CHU_1110 from Cytophaga hutchinsonii, Northeast Structural Genomics Consortium Target ChR152
PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2lf2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2lf2a1 d.129.3.0 (A:1-167) automated matches {Cytophaga hutchinsonii [TaxId: 269798]}
mrtdlaldfsvnkenktitikrefaavraivweaftraeildqwwapkpwkaktksmdfk
eggtwlyamvgpngeehwsiceyaiikpierftgkdgftdasgklntemprsnwdmrfid
kgeitevqyhisyddvaqleatiqmgfkegitmamenldellvsgkk

SCOPe Domain Coordinates for d2lf2a1:

Click to download the PDB-style file with coordinates for d2lf2a1.
(The format of our PDB-style files is described here.)

Timeline for d2lf2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2lf2a2