SCOPe 2.08: Domain d2ldka1: 2ldk A:1-164

Lineage for d2ldka1 (2ldk A:1-164)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Arthrobacter aurescens [TaxId:290340] [255428] (1 PDB entry)

8. Domain d2ldka1: 2ldk A:1-164 [242849]
   Other proteins in same PDB: d2ldka2
   automated match to d3uidb_

Details for d2ldka1

PDB Entry: 2ldk

PDB Description: Solution NMR Structure of Protein AAur_3427 from Arthrobacter aurescens, Northeast Structural Genomics Consortium Target AaR96

PDB Compounds: (A:) Uncharacterized protein

SCOPe Domain Sequences for d2ldka1:

Sequence; same for both SEQRES and ATOM records:

>d2ldka1 d.129.3.0 (A:1-164) automated matches {Arthrobacter aurescens [TaxId: 290340]}
tvvsvdkdvealsfsivaefdadvkrvwaiwedprqlerwwgpptwpatfetheftvggk
aayymtgpdgtkargwwqfttieapdhlefddgfadehgapvdelgvthatvkleplenr
trmtiistfeseeqmqkmaemgmeegmreaieqidavlsepana

Timeline for d2ldka1:

• d2ldka1 first appeared in SCOPe 2.04, called d2ldka_
  
• d2ldka1 appears in SCOPe 2.07