Lineage for d7cel__ (7cel -)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 164500Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 164501Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) (S)
  5. 164991Family b.29.1.10: Glycosyl hydrolase family 7 catalitic core [49971] (1 protein)
  6. 164992Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (5 species)
  7. 165013Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (9 PDB entries)
  8. 165018Domain d7cel__: 7cel - [24282]

Details for d7cel__

PDB Entry: 7cel (more details), 1.9 Å

PDB Description: cbh1 (e217q) in complex with cellohexaose and cellobiose

SCOP Domain Sequences for d7cel__:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cel__ b.29.1.10 (-) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOP Domain Coordinates for d7cel__:

Click to download the PDB-style file with coordinates for d7cel__.
(The format of our PDB-style files is described here.)

Timeline for d7cel__: