Lineage for d7cel__ (7cel -)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 58007Family b.29.1.10: Endoglucanase/cellulase I catalitic core [49971] (2 proteins)
  6. 58008Protein Cellobiohydrolase I (cellulase), CBH1, Cel7A [49972] (1 species)
  7. 58009Species Trichoderma reesei [TaxId:51453] [49973] (9 PDB entries)
  8. 58014Domain d7cel__: 7cel - [24282]

Details for d7cel__

PDB Entry: 7cel (more details), 1.9 Å

PDB Description: cbh1 (e217q) in complex with cellohexaose and cellobiose

SCOP Domain Sequences for d7cel__:

Sequence; same for both SEQRES and ATOM records: (download)

>d7cel__ b.29.1.10 (-) Cellobiohydrolase I (cellulase), CBH1, Cel7A {Trichoderma reesei}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiwqansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOP Domain Coordinates for d7cel__:

Click to download the PDB-style file with coordinates for d7cel__.
(The format of our PDB-style files is described here.)

Timeline for d7cel__: