Lineage for d2l9la_ (2l9l A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530952Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 1530953Protein automated matches [190770] (24 species)
    not a true protein
  7. 1531137Species Mouse (Mus musculus) [TaxId:10090] [255419] (1 PDB entry)
  8. 1531138Domain d2l9la_: 2l9l A: [242819]
    automated match to d1d7pm_

Details for d2l9la_

PDB Entry: 2l9l (more details)

PDB Description: NMR Structure of the Mouse MFG-E8 C2 Domain
PDB Compounds: (A:) Lactadherin

SCOPe Domain Sequences for d2l9la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l9la_ b.18.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mksghgcseplglknntipdsqmsasssyktwnlrafgwyphlgrldnqgkinawtaqsn
sakewlqvdlgtqrqvtgiitqgardfghiqyvasykvahsddgvqwtvyeeqgsskvfq
gnldnnshkknifekpfmaryvrvlpvswhnritlrlellgcle

SCOPe Domain Coordinates for d2l9la_:

Click to download the PDB-style file with coordinates for d2l9la_.
(The format of our PDB-style files is described here.)

Timeline for d2l9la_: