Lineage for d1celb_ (1cel B:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108963Family b.29.1.10: Glycosyl hydrolase family 7 catalitic core [49971] (1 protein)
  6. 108964Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (5 species)
  7. 108985Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (9 PDB entries)
  8. 108988Domain d1celb_: 1cel B: [24281]

Details for d1celb_

PDB Entry: 1cel (more details), 1.81 Å

PDB Description: the three-dimensional crystal structure of the catalytic core of cellobiohydrolase i from trichoderma reesei

SCOP Domain Sequences for d1celb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1celb_ b.29.1.10 (B:) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOP Domain Coordinates for d1celb_:

Click to download the PDB-style file with coordinates for d1celb_.
(The format of our PDB-style files is described here.)

Timeline for d1celb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cela_