Lineage for d6cel__ (6cel -)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108963Family b.29.1.10: Glycosyl hydrolase family 7 catalitic core [49971] (1 protein)
  6. 108964Protein Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) [68900] (5 species)
  7. 108985Species Trichoderma reesei, Cel7A [TaxId:51453] [68898] (9 PDB entries)
  8. 108986Domain d6cel__: 6cel - [24279]

Details for d6cel__

PDB Entry: 6cel (more details), 1.7 Å

PDB Description: cbh1 (e212q) cellopentaose complex

SCOP Domain Sequences for d6cel__:

Sequence; same for both SEQRES and ATOM records: (download)

>d6cel__ b.29.1.10 (-) Cellobiohydrolase I (cellulase, Endoglucanase I, CBH1) {Trichoderma reesei, Cel7A}
esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl
cpdnetcaknccldgaayastygvttsgnslsidfvtqsaqknvgarlylmasdttyqef
tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl
kfingqanvegwepssnnantgigghgsccsqmdiweansisealtphpcttvgqeiceg
dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai
nryyvqngvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm
vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn
ikfgpigstgnpsg

SCOP Domain Coordinates for d6cel__:

Click to download the PDB-style file with coordinates for d6cel__.
(The format of our PDB-style files is described here.)

Timeline for d6cel__: