Class b: All beta proteins [48724] (180 folds) |
Fold b.60: Lipocalins [50813] (1 superfamily) barrel, closed or opened; n=8, S=12; meander |
Superfamily b.60.1: Lipocalins [50814] (10 families) bind hydrophobic ligands in their interior |
Family b.60.1.0: automated matches [191454] (1 protein) not a true family |
Protein automated matches [190698] (25 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [188898] (2 PDB entries) |
Domain d2l5pa_: 2l5p A: [242778] automated match to d2czta_ |
PDB Entry: 2l5p (more details)
SCOPe Domain Sequences for d2l5pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2l5pa_ b.60.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} gqsptmpqgfsqmtsfqsnkfqgewfvlgladntykrehrpllhsfitlfklrdnsefqv tnsmtrgkhcstwsytliptnkpgqftrdnrgsgpgadkeniqvietdyvkfalvlslrq asnqnitrvsllgrdwkithktidrfialtktqnltknnllfpdltdwlldpkvc
Timeline for d2l5pa_: