Lineage for d2l5pa_ (2l5p A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2805574Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2805575Protein automated matches [190698] (25 species)
    not a true protein
  7. 2805720Species Norway rat (Rattus norvegicus) [TaxId:10116] [188898] (2 PDB entries)
  8. 2805723Domain d2l5pa_: 2l5p A: [242778]
    automated match to d2czta_

Details for d2l5pa_

PDB Entry: 2l5p (more details)

PDB Description: Solution NMR structure of protein lipocalin 12 from rat epididymis
PDB Compounds: (A:) Lipocalin 12

SCOPe Domain Sequences for d2l5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l5pa_ b.60.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gqsptmpqgfsqmtsfqsnkfqgewfvlgladntykrehrpllhsfitlfklrdnsefqv
tnsmtrgkhcstwsytliptnkpgqftrdnrgsgpgadkeniqvietdyvkfalvlslrq
asnqnitrvsllgrdwkithktidrfialtktqnltknnllfpdltdwlldpkvc

SCOPe Domain Coordinates for d2l5pa_:

Click to download the PDB-style file with coordinates for d2l5pa_.
(The format of our PDB-style files is described here.)

Timeline for d2l5pa_: