Lineage for d2l05a_ (2l05 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1637452Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1638517Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 1638518Protein automated matches [190233] (10 species)
    not a true protein
  7. 1638535Species Human (Homo sapiens) [TaxId:9606] [187090] (41 PDB entries)
  8. 1638584Domain d2l05a_: 2l05 A: [242718]
    automated match to d3ny5b_

Details for d2l05a_

PDB Entry: 2l05 (more details)

PDB Description: Solution NMR Structure of the Ras-binding domain of Serine/threonine-protein kinase B-raf from Homo sapiens, Northeast Structural Genomics Consortium Target HR4694F
PDB Compounds: (A:) Serine/threonine-protein kinase B-raf

SCOPe Domain Sequences for d2l05a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2l05a_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
hmpkspqkpivrvflpnkqrtvvparcgvtvrdslkkalmmrglipeccavyriqdgekk
pigwdtdiswltgeelhvevlenvpl

SCOPe Domain Coordinates for d2l05a_:

Click to download the PDB-style file with coordinates for d2l05a_.
(The format of our PDB-style files is described here.)

Timeline for d2l05a_: