SCOPe 2.08: Domain d2kyxa1: 2kyx A:3-83

Lineage for d2kyxa1 (2kyx A:3-83)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)

8. Domain d2kyxa1: 2kyx A:3-83 [242705]
   Other proteins in same PDB: d2kyxa2
   automated match to d2cqba1

Details for d2kyxa1

PDB Entry: 2kyx

PDB Description: solution structure of the rrm domain of cyp33

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase e

SCOPe Domain Sequences for d2kyxa1:

Sequence; same for both SEQRES and ATOM records:

>d2kyxa1 d.58.7.1 (A:3-83) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ttkrvlyvgglaeevddkvlhaafipfgditdiqipldyetekhrgfafvefelaedaaa
aidnmneselfgrtirvnlak

Timeline for d2kyxa1:

• d2kyxa1 first appeared in SCOPe 2.04, called d2kyxa_
  
• d2kyxa1 appears in SCOPe 2.07