Lineage for d1f31a1 (1f31 A:862-1079)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12782Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)
  6. 12783Protein Botulinum neurotoxin [49959] (2 species)
  7. 12786Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (2 PDB entries)
  8. 12788Domain d1f31a1: 1f31 A:862-1079 [24270]
    Other proteins in same PDB: d1f31a2, d1f31a3, d1f31a4

Details for d1f31a1

PDB Entry: 1f31 (more details), 2.6 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with a trisaccharide

SCOP Domain Sequences for d1f31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f31a1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

SCOP Domain Coordinates for d1f31a1:

Click to download the PDB-style file with coordinates for d1f31a1.
(The format of our PDB-style files is described here.)

Timeline for d1f31a1: