SCOPe 2.06: Domain d2kv3a1: 2kv3 A:2-131

Lineage for d2kv3a1 (2kv3 A:2-131)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.0: automated matches [191331] (1 protein)
   not a true family

6. Protein automated matches [190159] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186882] (78 PDB entries)

8. Domain d2kv3a1: 2kv3 A:2-131 [242672]
   Other proteins in same PDB: d2kv3a2
   automated match to d3bx4c_
   mutant

Details for d2kv3a1

PDB Entry: 2kv3

PDB Description: human regenerating gene type iv (reg iv) protein, p91s mutant

PDB Compounds: (A:) Regenerating islet-derived protein 4

SCOPe Domain Sequences for d2kv3a1:

Sequence; same for both SEQRES and ATOM records:

>d2kv3a1 d.169.1.0 (A:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scapgwfyhksncygyfrklrnwsdaelecqsygngahlasilslkeastiaeyisgyqr
sqsiwiglhdpqkrqqwqwidgamylyrswsgksmggnkhcaemssnnnfltwssnecnk
rqhflckyrp

Timeline for d2kv3a1:

• d2kv3a1 first appeared in SCOPe 2.04, called d2kv3a_
  
• d2kv3a1 was called d2kv3a_ in SCOPe 2.05
  
• d2kv3a1 appears in SCOPe 2.07
  
• d2kv3a1 appears in the current release, SCOPe 2.08