Lineage for d2kv3a1 (2kv3 A:2-131)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (17 species)
    not a true protein
  7. 2559734Species Human (Homo sapiens) [TaxId:9606] [186882] (84 PDB entries)
  8. 2559973Domain d2kv3a1: 2kv3 A:2-131 [242672]
    Other proteins in same PDB: d2kv3a2
    automated match to d3bx4c_
    mutant

Details for d2kv3a1

PDB Entry: 2kv3 (more details)

PDB Description: human regenerating gene type iv (reg iv) protein, p91s mutant
PDB Compounds: (A:) Regenerating islet-derived protein 4

SCOPe Domain Sequences for d2kv3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kv3a1 d.169.1.0 (A:2-131) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scapgwfyhksncygyfrklrnwsdaelecqsygngahlasilslkeastiaeyisgyqr
sqsiwiglhdpqkrqqwqwidgamylyrswsgksmggnkhcaemssnnnfltwssnecnk
rqhflckyrp

SCOPe Domain Coordinates for d2kv3a1:

Click to download the PDB-style file with coordinates for d2kv3a1.
(The format of our PDB-style files is described here.)

Timeline for d2kv3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kv3a2