Lineage for d2ku2b1 (2ku2 B:1-233)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224590Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2224591Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2224775Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2228394Protein automated matches [190144] (11 species)
    not a true protein
  7. 2230420Species Thermoplasma acidophilum [TaxId:2303] [186869] (7 PDB entries)
  8. 2230485Domain d2ku2b1: 2ku2 B:1-233 [242658]
    Other proteins in same PDB: d2ku2a2, d2ku2b2, d2ku2c2, d2ku2d2, d2ku2e2, d2ku2f2, d2ku2g2
    automated match to d1yaua_

Details for d2ku2b1

PDB Entry: 2ku2 (more details)

PDB Description: dynamic regulation of archaeal proteasome gate opening as studied by trosy-nmr
PDB Compounds: (B:) Proteasome subunit alpha

SCOPe Domain Sequences for d2ku2b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ku2b1 d.153.1.4 (B:1-233) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d2ku2b1:

Click to download the PDB-style file with coordinates for d2ku2b1.
(The format of our PDB-style files is described here.)

Timeline for d2ku2b1: