Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species) contains an extension to the common fold at the N-terminus |
Species Thermoplasma acidophilum [TaxId:2303] [56256] (8 PDB entries) |
Domain d2ku2b1: 2ku2 B:1-233 [242658] Other proteins in same PDB: d2ku2a2, d2ku2b2, d2ku2c2, d2ku2d2, d2ku2e2, d2ku2f2, d2ku2g2 automated match to d1yaua_ |
PDB Entry: 2ku2 (more details)
SCOPe Domain Sequences for d2ku2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ku2b1 d.153.1.4 (B:1-233) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]} mqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl
Timeline for d2ku2b1: