Lineage for d2ku1g1 (2ku1 G:1-233)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2988641Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2990901Species Thermoplasma acidophilum [TaxId:2303] [56256] (8 PDB entries)
  8. 2990950Domain d2ku1g1: 2ku1 G:1-233 [242656]
    Other proteins in same PDB: d2ku1a2, d2ku1b2, d2ku1c2, d2ku1d2, d2ku1e2, d2ku1f2, d2ku1g2
    automated match to d1ya7a_

Details for d2ku1g1

PDB Entry: 2ku1 (more details)

PDB Description: dynamic regulation of archaeal proteasome gate opening as studied by trosy-nmr
PDB Compounds: (G:) Proteasome subunit alpha

SCOPe Domain Sequences for d2ku1g1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ku1g1 d.153.1.4 (G:1-233) Proteasome alpha subunit (non-catalytic) {Thermoplasma acidophilum [TaxId: 2303]}
mqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlie
qnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqm
qqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsflerey
kenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d2ku1g1:

Click to download the PDB-style file with coordinates for d2ku1g1.
(The format of our PDB-style files is described here.)

Timeline for d2ku1g1: