Lineage for d2ksqa_ (2ksq A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845934Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1846955Protein automated matches [190047] (27 species)
    not a true protein
  7. 1846956Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187069] (9 PDB entries)
  8. 1846972Domain d2ksqa_: 2ksq A: [242639]
    automated match to d3lrpa_
    complexed with gtp, mtn

Details for d2ksqa_

PDB Entry: 2ksq (more details)

PDB Description: The myristoylated yeast ARF1 in a GTP and bicelle bound conformation
PDB Compounds: (A:) ADP-ribosylation factor 1

SCOPe Domain Sequences for d2ksqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ksqa_ c.37.1.8 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
xglfasklfsnlfgnkemrilmvgldgagkttvlyklklgevittiptigfnvecvqycn
isftvwdvggqdrirslwrhyycntegvifvvdsndrsrigearevmqrmlnedelcnaa
wlvfankqdlpeamsaaeiteklglhsirnrpwfiqatcatsgeglyeglewlsnclkns
t

SCOPe Domain Coordinates for d2ksqa_:

Click to download the PDB-style file with coordinates for d2ksqa_.
(The format of our PDB-style files is described here.)

Timeline for d2ksqa_: