SCOPe 2.06: Domain d2kspa1: 2ksp A:40-139

Lineage for d2kspa1 (2ksp A:40-139)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (30 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (51 PDB entries)

8. Domain d2kspa1: 2ksp A:40-139 [242638]
   Other proteins in same PDB: d2kspa2
   automated match to d1ff1a_
   complexed with ca

Details for d2kspa1

PDB Entry: 2ksp

PDB Description: mechanism for the selective interaction of c-terminal eh-domain proteins with specific npf-containing partners

PDB Compounds: (A:) EH domain-containing protein 1

SCOPe Domain Sequences for d2kspa1:

Sequence; same for both SEQRES and ATOM records:

>d2kspa1 a.39.1.0 (A:40-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ddvewvvgkdkptydeifytlspvngkitganakkemvksklpntvlgkiwkladvdkdg
llddeefalanhlikvkleghelpadlpphlvppskrrhe

Timeline for d2kspa1:

• d2kspa1 first appeared in SCOPe 2.04, called d2kspa_
  
• d2kspa1 was called d2kspa_ in SCOPe 2.05
  
• d2kspa1 appears in SCOPe 2.07
  
• d2kspa1 appears in the current release, SCOPe 2.08