SCOPe 2.06: Domain d1dlla1: 1dll A:875-1110

Lineage for d1dlla1 (1dll A:875-1110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 proteins)
   automatically mapped to Pfam PF07953

6. Protein Tetanus neurotoxin [49957] (1 species)

7. Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)

8. Domain d1dlla1: 1dll A:875-1110 [24263]
   Other proteins in same PDB: d1dlla2
   complexed with gol, lat

Details for d1dlla1

PDB Entry: 1dll, 1.8 Å

PDB Description: the hc fragement of tetanus toxin complexed with lactose

PDB Compounds: (A:) Tetanus toxin

SCOPe Domain Sequences for d1dlla1:

Sequence; same for both SEQRES and ATOM records:

>d1dlla1 b.29.1.6 (A:875-1110) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls

Timeline for d1dlla1:

• d1dlla1 first appeared (with stable ids) in SCOP 1.55
  
• d1dlla1 appears in SCOPe 2.05
  
• d1dlla1 appears in SCOPe 2.07
  
• d1dlla1 appears in the current release, SCOPe 2.08