Lineage for d2kroa_ (2kro A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1784036Species Mouse (Mus musculus) [TaxId:10090] [189303] (23 PDB entries)
  8. 1784049Domain d2kroa_: 2kro A: [242628]
    automated match to d2xmfa_

Details for d2kroa_

PDB Entry: 2kro (more details)

PDB Description: RDC refined high resolution structure of the third SH3 domain of CD2AP
PDB Compounds: (A:) CD2-associated protein

SCOPe Domain Sequences for d2kroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kroa_ b.34.2.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gamgakeycrtlfpytgtnedeltfregeiihlisketgeagwwkgelngkegvfpdnfa
vqis

SCOPe Domain Coordinates for d2kroa_:

Click to download the PDB-style file with coordinates for d2kroa_.
(The format of our PDB-style files is described here.)

Timeline for d2kroa_: