Lineage for d2kp5a_ (2kp5 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773616Family b.11.1.0: automated matches [191607] (1 protein)
    not a true family
  6. 2773617Protein automated matches [191109] (11 species)
    not a true protein
  7. 2773664Species Hahella chejuensis [TaxId:349521] [255368] (1 PDB entry)
  8. 2773665Domain d2kp5a_: 2kp5 A: [242608]
    automated match to d3hzbd_

Details for d2kp5a_

PDB Entry: 2kp5 (more details)

PDB Description: NMR structure of Hahellin, a beta-gamma crystallin
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d2kp5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kp5a_ b.11.1.0 (A:) automated matches {Hahella chejuensis [TaxId: 349521]}
gektvklyedthfkgysvelpvgdynlsslisrgalnddlssarvpsglrlevfqhnnfk
gvrdfytsdaaelsrdndassvrvskmettn

SCOPe Domain Coordinates for d2kp5a_:

Click to download the PDB-style file with coordinates for d2kp5a_.
(The format of our PDB-style files is described here.)

Timeline for d2kp5a_: