Class b: All beta proteins [48724] (180 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.0: automated matches [191607] (1 protein) not a true family |
Protein automated matches [191109] (11 species) not a true protein |
Species Hahella chejuensis [TaxId:349521] [255368] (1 PDB entry) |
Domain d2kp5a_: 2kp5 A: [242608] automated match to d3hzbd_ |
PDB Entry: 2kp5 (more details)
SCOPe Domain Sequences for d2kp5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kp5a_ b.11.1.0 (A:) automated matches {Hahella chejuensis [TaxId: 349521]} gektvklyedthfkgysvelpvgdynlsslisrgalnddlssarvpsglrlevfqhnnfk gvrdfytsdaaelsrdndassvrvskmettn
Timeline for d2kp5a_: