SCOPe 2.06: Domain d2klca_: 2klc A:

Lineage for d2klca_ (2klc A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)

8. Domain d2klca_: 2klc A: [242550]
   automated match to d1yqba1

Details for d2klca_

PDB Entry: 2klc

PDB Description: nmr solution structure of human ubiquitin-like domain of ubiquilin 1, northeast structural genomics consortium (nesg) target ht5a

PDB Compounds: (A:) Ubiquilin-1

SCOPe Domain Sequences for d2klca_:

Sequence; same for both SEQRES and ATOM records:

>d2klca_ d.15.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pkimkvtvktpkekeefavpenssvqqfkeeiskrfkshtdqlvlifagkilkdqdtlsq
hgihdgltvhlviktqnrp

Timeline for d2klca_:

• d2klca_ first appeared in SCOPe 2.04
  
• d2klca_ appears in SCOPe 2.05
  
• d2klca_ appears in SCOPe 2.07
  
• d2klca_ appears in the current release, SCOPe 2.08