Lineage for d2kkza1 (2kkz A:84-215)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010233Fold d.299: Ns1 effector domain-like [143020] (1 superfamily)
    beta-X-beta(5)-alpha-beta-alpha; 2 layers: a/b; bifurcated beta-sheet; order 23654[1,7]
  4. 3010234Superfamily d.299.1: Ns1 effector domain-like [143021] (1 family) (S)
    automatically mapped to Pfam PF00600
  5. 3010235Family d.299.1.1: Ns1 effector domain-like [143022] (2 proteins)
    C-terminal part of Pfam PF00600
  6. 3010240Protein automated matches [190936] (7 species)
    not a true protein
  7. 3010283Species Influenza A virus [TaxId:221021] [255355] (1 PDB entry)
  8. 3010284Domain d2kkza1: 2kkz A:84-215 [242547]
    Other proteins in same PDB: d2kkza2
    automated match to d3o9sa_
    mutant

Details for d2kkza1

PDB Entry: 2kkz (more details)

PDB Description: solution nmr structure of the monomeric w187r mutant of a/udorn ns1 effector domain. northeast structural genomics target or8c[w187r].
PDB Compounds: (A:) Non-structural protein NS1

SCOPe Domain Sequences for d2kkza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kkza1 d.299.1.1 (A:84-215) automated matches {Influenza A virus [TaxId: 221021]}
mpasryitdmtieelsrdwfmlmpkqkvegplciridqaimdknimlkanfsvifdrlet
lillrafteegaivgeisplpsfpghtiedvknaigvligglerndntvrvsktlqrfaw
gssnengrpplt

SCOPe Domain Coordinates for d2kkza1:

Click to download the PDB-style file with coordinates for d2kkza1.
(The format of our PDB-style files is described here.)

Timeline for d2kkza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kkza2