Lineage for d2ki6f_ (2ki6 F:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1775883Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1775884Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1776026Family b.7.1.2: Synaptotagmin-like (S variant) [49575] (11 proteins)
    topologically similar to the C-terminal domain of PapD
  6. 1776050Protein Synaptogamin I [49576] (2 species)
    duplication: contains tandem repeat of two similar domains
  7. 1776051Species Human (Homo sapiens) [TaxId:9606] [158946] (10 PDB entries)
  8. 1776065Domain d2ki6f_: 2ki6 F: [242529]
    Other proteins in same PDB: d2ki6b_, d2ki6c_, d2ki6d_, d2ki6e_
    automated match to d1byna_

Details for d2ki6f_

PDB Entry: 2ki6 (more details)

PDB Description: The FGF1-S100A13-C2A hetero-hexameric complex structure: A component in the non-classical pathway for FGF1 secretion
PDB Compounds: (F:) Synaptotagmin-1

SCOPe Domain Sequences for d2ki6f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ki6f_ b.7.1.2 (F:) Synaptogamin I {Human (Homo sapiens) [TaxId: 9606]}
eklgklqysldydfqnnqllvgiiqaaelpaldmggtsdpyvkvfllpdkkkkfetkvhr
ktlnpvfneqftfkvpyselggktlvmavydfdrfskhdiigefkvpmntvdfghvteew
rdlqsaek

SCOPe Domain Coordinates for d2ki6f_:

Click to download the PDB-style file with coordinates for d2ki6f_.
(The format of our PDB-style files is described here.)

Timeline for d2ki6f_: