SCOPe 2.05: Domain d2ki6e_: 2ki6 E:

Lineage for d2ki6e_ (2ki6 E:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.1: Cytokine [50353] (3 families)

5. Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)

6. Protein Acidic FGF (FGF1) [50357] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50359] (92 PDB entries)
   Uniprot P05230 16-152 ! Uniprot P05230

8. Domain d2ki6e_: 2ki6 E: [242528]
   Other proteins in same PDB: d2ki6a_, d2ki6c_, d2ki6d_, d2ki6f_
   automated match to d1djsb_

Details for d2ki6e_

PDB Entry: 2ki6

PDB Description: The FGF1-S100A13-C2A hetero-hexameric complex structure: A component in the non-classical pathway for FGF1 secretion

PDB Compounds: (E:) heparin-binding growth factor 1

SCOPe Domain Sequences for d2ki6e_:

Sequence; same for both SEQRES and ATOM records:

>d2ki6e_ b.42.1.1 (E:) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
ykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyikstetgqylam
dtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngsckrgprthygq
kailflplpvssd

Timeline for d2ki6e_:

• d2ki6e_ first appeared in SCOPe 2.04
  
• d2ki6e_ appears in SCOPe 2.06
  
• d2ki6e_ appears in the current release, SCOPe 2.08