Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (9 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [255348] (1 PDB entry) |
Domain d2ki2a_: 2ki2 A: [242518] automated match to d3ucga_ protein/DNA complex; protein/RNA complex |
PDB Entry: 2ki2 (more details)
SCOPe Domain Sequences for d2ki2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ki2a_ d.58.7.0 (A:) automated matches {Helicobacter pylori [TaxId: 210]} mrniyvgnlvysatseqvkelfsqfgkvfnvkliydretkkpkgfgfvemqeesvseaia kldntdfmgrtirvtea
Timeline for d2ki2a_: