SCOPe 2.08: Domain d2khja1: 2khj A:2-89

Lineage for d2khja1 (2khj A:2-89)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (52 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255345] (2 PDB entries)

8. Domain d2khja1: 2khj A:2-89 [242512]
   Other proteins in same PDB: d2khja2
   automated match to d1sroa_

Details for d2khja1

PDB Entry: 2khj

PDB Description: nmr structure of the domain 6 of the e. coli ribosomal protein s1

PDB Compounds: (A:) 30S ribosomal protein S1

SCOPe Domain Sequences for d2khja1:

Sequence; same for both SEQRES and ATOM records:

>d2khja1 b.40.4.0 (A:2-89) automated matches {Escherichia coli [TaxId: 562]}
fnnwvalnkkgaivtgkvtavdakgatveladgvegylraseasrdrvedatlvlsvgde
veakftgvdrknraislsvrakdeadek

Timeline for d2khja1:

• d2khja1 first appeared in SCOPe 2.04, called d2khja_
  
• d2khja1 appears in SCOPe 2.07