Lineage for d2kgka_ (2kgk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904038Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [188674] (20 PDB entries)
  8. 2904119Domain d2kgka_: 2kgk A: [242508]
    automated match to d4elha_
    complexed with n22, nap

Details for d2kgka_

PDB Entry: 2kgk (more details)

PDB Description: solution structure of bacillus anthracis dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d2kgka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kgka_ c.71.1.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
mivsfmvamdenrvigkdnnlpwrlpselqyvkkttmghplimgrknyeaigrplpgrrn
iivtrnegyhvegcevahsveevfelckneeeififggaqiydlflpyvdklyitkihha
fegdtffpemdmtnwkevfvekgltdeknpytyyyhvyekqq

SCOPe Domain Coordinates for d2kgka_:

Click to download the PDB-style file with coordinates for d2kgka_.
(The format of our PDB-style files is described here.)

Timeline for d2kgka_: