Class a: All alpha proteins [46456] (286 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (16 species) not a true protein |
Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries) |
Domain d2kdza2: 2kdz A:50-107 [242474] automated match to d3osga2 protein/DNA complex |
PDB Entry: 2kdz (more details)
SCOPe Domain Sequences for d2kdza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kdza2 a.4.1.0 (A:50-107) automated matches {Trichomonas vaginalis [TaxId: 5722]} alrtdpwspeedmlldqkyaeygpkwnkiskflknrsdnnirnrwmmiarhrakhqks
Timeline for d2kdza2: