SCOPe 2.05: Domain d2kdza1: 2kdz A:1-49

Lineage for d2kdza1 (2kdz A:1-49)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (16 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries)

8. Domain d2kdza1: 2kdz A:1-49 [242473]
   automated match to d3osgd1
   protein/DNA complex

Details for d2kdza1

PDB Entry: 2kdz

PDB Description: structure of the r2r3 dna binding domain of myb1 protein from protozoan parasite trichomonas vaginalis in complex with mre-1/mre-2r dna

PDB Compounds: (A:) myb24

SCOPe Domain Sequences for d2kdza1:

Sequence; same for both SEQRES and ATOM records:

>d2kdza1 a.4.1.0 (A:1-49) automated matches {Trichomonas vaginalis [TaxId: 5722]}
kvkfteeedlklqqlvmrygakdwirisqlmitrnprqcrerwnnyinp

Timeline for d2kdza1:

• d2kdza1 first appeared in SCOPe 2.04
  
• d2kdza1 appears in SCOPe 2.06
  
• d2kdza1 appears in the current release, SCOPe 2.08