SCOPe 2.06: Domain d2kbea_: 2kbe A:

Lineage for d2kbea_ (2kbe A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (12 PDB entries)

8. Domain d2kbea_: 2kbe A: [242450]
   automated match to d3fhcb_
   protein/RNA complex

Details for d2kbea_

PDB Entry: 2kbe

PDB Description: solution structure of amino-terminal domain of dbp5p

PDB Compounds: (A:) ATP-dependent RNA helicase DBP5

SCOPe Domain Sequences for d2kbea_:

Sequence; same for both SEQRES and ATOM records:

>d2kbea_ c.37.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
yevkvkladiqadpnsplysaksfdelglapellkgiyamkfqkpskiqeralplllhnp
prnmiaqsqsgtgktaafsltmltrvnpedaspqaiclapsrelarqtlevvqemgkftk
itsqlivpdsfeknkqinaqvivgtpgtvldlmrrklmqlqkikifvldeadnmldqqgl
gdqcirvkrflpkdtqlvlfsatfadavrqyakkivpnantlelqt

Timeline for d2kbea_:

• d2kbea_ first appeared in SCOPe 2.04
  
• d2kbea_ appears in SCOPe 2.05
  
• d2kbea_ appears in SCOPe 2.07
  
• d2kbea_ appears in the current release, SCOPe 2.08