SCOPe 2.08: Domain d2kaya_: 2kay A:

Lineage for d2kaya_ (2kay A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (36 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (58 PDB entries)

8. Domain d2kaya_: 2kay A: [242444]
   automated match to d2y5ia_
   complexed with ca

Details for d2kaya_

PDB Entry: 2kay

PDB Description: solution structure and dynamics of s100a5 in the ca2+ -bound states

PDB Compounds: (A:) Protein S100-A5

SCOPe Domain Sequences for d2kaya_:

Sequence; same for both SEQRES and ATOM records:

>d2kaya_ a.39.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
metplekalttmvttfhkysgregskltlsrkelkelikkelclgemkessiddlmksld
knsdqeidfkeysvfltmlcmayndfflednk

Timeline for d2kaya_:

• d2kaya_ first appeared in SCOPe 2.04
  
• d2kaya_ appears in SCOPe 2.07