Lineage for d2kaja_ (2kaj A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2179170Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2179171Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins)
  6. 2179304Protein automated matches [190231] (9 species)
    not a true protein
  7. 2179345Species Synechocystis sp. [TaxId:1148] [255333] (1 PDB entry)
  8. 2179346Domain d2kaja_: 2kaj A: [242440]
    automated match to d1doya_
    complexed with ga

Details for d2kaja_

PDB Entry: 2kaj (more details)

PDB Description: nmr structure of gallium substituted ferredoxin
PDB Compounds: (A:) Ferredoxin-1

SCOPe Domain Sequences for d2kaja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kaja_ d.15.4.1 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
asytvklitpdgessiecsddtyildaaeeagldlpyscragacstcagkitagsvdqsd
qsfldddqieagyvltcvayptsdctiethkeedly

SCOPe Domain Coordinates for d2kaja_:

Click to download the PDB-style file with coordinates for d2kaja_.
(The format of our PDB-style files is described here.)

Timeline for d2kaja_: