Lineage for d2ka3b_ (2ka3 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779160Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1779161Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1779444Family b.22.1.0: automated matches [191519] (1 protein)
    not a true family
  6. 1779445Protein automated matches [190873] (3 species)
    not a true protein
  7. 1779446Species Human (Homo sapiens) [TaxId:9606] [188225] (20 PDB entries)
  8. 1779485Domain d2ka3b_: 2ka3 B: [242435]
    automated match to d4f3ja_

Details for d2ka3b_

PDB Entry: 2ka3 (more details)

PDB Description: Structure of EMILIN-1 C1Q-like domain
PDB Compounds: (B:) emilin-1

SCOPe Domain Sequences for d2ka3b_:

Sequence, based on SEQRES records: (download)

>d2ka3b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
ekveavlsrsnqgvarvdsggyepeglenkpvaesqpspgtlgvfslilplqagdtvcvd
lvmgqlahseepltifsgallygdpeleha

Sequence, based on observed residues (ATOM records): (download)

>d2ka3b_ b.22.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvpqvafsaalslprsepgtvpfdrvllndggyydpetgvftaplagryllsavltghrh
ekveavlsrsnqgvarvdsggtlgvfslilplqagdtvcvdlvmgqlahseepltifsga
llygdpeleha

SCOPe Domain Coordinates for d2ka3b_:

Click to download the PDB-style file with coordinates for d2ka3b_.
(The format of our PDB-style files is described here.)

Timeline for d2ka3b_: